DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angpt1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_571888.1 Gene:angpt1 / 114407 ZFINID:ZDB-GENE-010817-1 Length:513 Species:Danio rerio


Alignment Length:265 Identity:99/265 - (37%)
Similarity:137/265 - (51%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 STA-QSNKLDLVYKKAESMVSSLKIRLEEL-----KQSYKEITEERGSHETINPSSCLAAGINSN 76
            ||| |..:.||:    |||.|.|.:..::.     ..|.|:..|||...:.   :....||...|
Zfish   255 STALQRQQQDLM----ESMRSLLSLCAKDAATAVEPNSTKQADEERKFRDC---ADLYQAGFQKN 312

  Fly    77 GIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLH 141
            |::.|.:...|...|||....||.||||||:|:||:.:|.:.|:||..|||.:|||.::|.|.:|
Zfish   313 GVYTINISPQETKKVYCVMESAGGGWTVIQKREDGTVDFQKTWKEYKMGFGSVSGEHWLGNEFVH 377

  Fly   142 FLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG--DSLRYHKGMPFS 204
            .||....:.|.|.:.|::|....::|:.|.|.:....|.| .|..:||.||  .||..| |..||
Zfish   378 VLTNQRQHGLRVELSDWDGHQAFSQYDSFHIDSEKQKYRL-FLKTHSGTAGRQSSLAVH-GADFS 440

  Fly   205 T--FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFV 267
            |  .|:|:....||.:..|.||||.|..|||||.|...|:...|.:  ||.|..::|..|..:..
Zfish   441 TKDVDNDNCTCKCALMLSGGWWYDACGPSNLNGVYYRQGQHVGKFN--GIKWHYFKGPSYSLRST 503

  Fly   268 QMMIR 272
            .||||
Zfish   504 VMMIR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 83/214 (39%)
angpt1NP_571888.1 RILP-like <206..272 CDD:304877 9/20 (45%)
FReD 298..508 CDD:238040 81/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6515
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.