DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Fgb

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_862897.1 Gene:Fgb / 110135 MGIID:99501 Length:481 Species:Mus musculus


Alignment Length:303 Identity:93/303 - (30%)
Similarity:149/303 - (49%) Gaps:55/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSC-------------LAAGI 73
            ::.:.|..:...|::..|:.::::|:   .:|:.:.....|....||             :..|.
Mouse   178 NDNIPLNLRVLRSILEDLRSKIQKLE---SDISAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGG 239

  Fly    74 NSNGIHVIEV-PGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE--------- 128
            .::.:::|:. ..::|:.||||.:....||||||.|||||.:|.|.|:.|.:|||.         
Mouse   240 ETSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDAKK 304

  Fly   129 ---LSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGD 190
               |.||:::|.:|:..||...|.||.:.|||:.|....|.|..|.:.|.::.|.:|| .||.|.
Mouse   305 YCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEASKYQVSV-NKYKGT 368

  Fly   191 AGDSL--------------RYHKGMPFSTFDHDDTG-------HGCARIYVGAWWYDQCQRSNLN 234
            ||::|              ..|.||.|||:|.|:.|       ..|::...|.|||::|..:|.|
Mouse   369 AGNALMDGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPN 433

  Fly   235 GQYLEGGRFEPKMSGR----GITWMSWRGYDYGYKFVQMMIRP 273
            |:|..||.:...||..    |:.||:|:|..|..:.:.|.|||
Mouse   434 GRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKIRP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/262 (33%)
FgbNP_862897.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..81
Beta-chain polymerization, binding distal domain of another fibrin. /evidence=ECO:0000250 35..37
Fib_alpha 82..224 CDD:285864 8/48 (17%)
FReD 227..476 CDD:294064 83/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.