DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and FGL2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_006673.1 Gene:FGL2 / 10875 HGNCID:3696 Length:439 Species:Homo sapiens


Alignment Length:307 Identity:104/307 - (33%)
Similarity:144/307 - (46%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESMVSSLKIRLEELK-------QSY------------------------KEI 53
            ::.|||....|.|:..::.|..|||:|.       ::|                        :|.
Human   135 SEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQ 199

  Fly    54 TEERGSHETI--NPSSCLAAGINSNGIH-VIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENF 115
            .:.|.....|  :.|...|.|..|:..: |...|....|.||||....|.||||:|.|.|||.||
Human   200 IQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNF 264

  Fly   116 YRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYA 180
            .|.|::|..|||.|..||::|.:|:|.||.::...|.:.:||||||...|.|:.|.:.|....|.
Human   265 TRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMILRIDLEDFNGVELYALYDQFYVANEFLKYR 329

  Fly   181 LSVLGKYSGDAGDSLRYHKGMP-----FSTFDHDDTGH---GCARIYVGAWWYDQCQRSNLNGQY 237
            |.| |.|:|.|||:||::|...     |:|.|.|:..:   .|...|...||:|.|..:||||:|
Human   330 LHV-GNYNGTAGDALRFNKHYNHDLKFFTTPDKDNDRYPSGNCGLYYSSGWWFDACLSANLNGKY 393

  Fly   238 LEGGRFEPKMSG--RGITWMSW--------RGYDYGYKFVQMMIRPK 274
                 :..|..|  .||.|.:|        .||...:|..:||||||
Human   394 -----YHQKYRGVRNGIFWGTWPGVSEAHPGGYKSSFKEAKMMIRPK 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 89/231 (39%)
FGL2NP_006673.1 DUF460 <28..>161 CDD:331991 9/25 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..126
FReD 209..435 CDD:294064 89/231 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.