DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and si:zfos-2330d3.6

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_009294456.1 Gene:si:zfos-2330d3.6 / 103909555 ZFINID:ZDB-GENE-110411-23 Length:242 Species:Danio rerio


Alignment Length:216 Identity:94/216 - (43%)
Similarity:127/216 - (58%) Gaps:10/216 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAG-----SGWTVIQRRQDGSENFYRCWEEYSQG 125
            |....:|...:|::.|...|..|..|||....:|     .||||.|||.|||.||:|.||||.:|
Zfish    27 SEIYKSGKTLSGVYSIYPAGNIPASVYCQMISSGKGGENGGWTVFQRRMDGSVNFFRPWEEYKRG 91

  Fly   126 FGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGD 190
            ||.:.||:::|||.|:.||..:.:.|.|.:|||.|....|:|..|::|:.:..|.|.|.|..:|.
Zfish    92 FGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKGFAQYSSFSVGSEAEGYKLQVSGFTNGG 156

  Fly   191 AGDSLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGIT 253
            |||||.||.||.|:|:|.|...|  .||||||||:||..|..:|.||.|| ||. :..:...|..
Zfish   157 AGDSLIYHSGMKFTTYDKDQDTHTQNCARIYVGAFWYKDCHNANPNGVYL-GGE-DKTLFAIGNV 219

  Fly   254 WMSWR-GYDYGYKFVQMMIRP 273
            |.:|: .::.|.||:.|.|:|
Zfish   220 WYTWKNNFEIGMKFITMKIKP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 94/216 (44%)
si:zfos-2330d3.6XP_009294456.1 FReD 23..241 CDD:238040 94/216 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6504
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.