DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and Angptl7

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_006239486.1 Gene:Angptl7 / 102552055 RGDID:7553363 Length:408 Species:Rattus norvegicus


Alignment Length:261 Identity:93/261 - (35%)
Similarity:139/261 - (53%) Gaps:10/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGINSNGIHVI--- 81
            :.|.:::.....|||..|.:..:::.::....:...:..:....:.||........:|::.:   
  Rat   148 SSSKRMESRLTTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPD 212

  Fly    82 EVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTA 146
            |..|.....|:||...:|.|||:||||:.|..:||:.|::|.||||.:.|:|::|.|.:|.| |.
  Rat   213 EFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRL-TR 276

  Fly   147 EPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG-DSLRYHKGMPFSTFDHDD 210
            :|..|.|.:||:.|....|.|..||:||...||.| .||.|||:.| |:|.||....|||.|.|:
  Rat   277 QPTRLRVELEDWEGNARYAEYSYFALGNELNSYRL-FLGNYSGNVGKDALLYHNNTVFSTKDKDN 340

  Fly   211 TG--HGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..  ..||::..|.:||:.|..|||||.|...|.....|.  ||:|..|.|.:|..|.|:|.|||
  Rat   341 DNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHRKHMD--GISWYGWHGANYSLKRVEMKIRP 403

  Fly   274 K 274
            :
  Rat   404 E 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/216 (40%)
Angptl7XP_006239486.1 FReD 191..403 CDD:238040 86/215 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.