DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and ANGPTL7

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_066969.1 Gene:ANGPTL7 / 10218 HGNCID:24078 Length:346 Species:Homo sapiens


Alignment Length:261 Identity:91/261 - (34%)
Similarity:139/261 - (53%) Gaps:10/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AQSNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSHETINPSSCLAAGINSNGIHVI--- 81
            :.|.:::.....|||..|.:..:::.::....:...:..:....:.||........:|::.:   
Human    86 SNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPD 150

  Fly    82 EVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTA 146
            :..|.....|:||...:|.|||:||||:.|..:|||.|::|.||||.:.|:|::|.|.:|.| :.
Human   151 DFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRL-SR 214

  Fly   147 EPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG-DSLRYHKGMPFSTFDHDD 210
            :|..|.|.|||:.|.:..|.|..|.:||...||.| .||.|:|:.| |:|:||....|||.|.|:
Human   215 QPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRL-FLGNYTGNVGNDALQYHNNTAFSTKDKDN 278

  Fly   211 TG--HGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
            ..  ..||::..|.:||:.|..|||||.|...|.....:.  ||||..|.|..|..|.|:|.|||
Human   279 DNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLD--GITWYGWHGSTYSLKRVEMKIRP 341

  Fly   274 K 274
            :
Human   342 E 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 85/216 (39%)
ANGPTL7NP_066969.1 SMC_N <37..>109 CDD:330553 5/22 (23%)
FReD 129..341 CDD:238040 84/215 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41874
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.