DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and si:ch211-157b11.8

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_009300879.1 Gene:si:ch211-157b11.8 / 101884863 ZFINID:ZDB-GENE-131127-436 Length:392 Species:Danio rerio


Alignment Length:290 Identity:97/290 - (33%)
Similarity:138/290 - (47%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SNKLDLVYKKAESMVSSLKIRLEELKQSYKEITEERGSH-----ETINPSSCL---------AAG 72
            |.:|..:..:.||:|.  |...::|....|.||..:.:.     .|:.||:.|         ..|
Zfish   114 SQRLREMATRLESVVG--KNGEKDLLLLLKSITHSKPNSLKPRTPTVPPSAGLYPQDCHEIYQLG 176

  Fly    73 INSNGIHVIE----VPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEF 133
            |..|||:.|:    .|.||   ..||...||.||||.|||.||..:|.|.|:||..|||....|.
Zfish   177 IKENGIYTIQPDPKQPALE---AVCDMVSAGGGWTVFQRRFDGKTDFNRTWQEYRDGFGSPQTEH 238

  Fly   134 FMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRY- 197
            ::|...|:.||....:.|.:.::|::.....|.|.:|.:...:..:.|:. .:|.||||::..| 
Zfish   239 WLGNAVLYALTANGQHTLRITLQDWHEQTRHANYNNFKVAGENQRFRLTA-REYHGDAGNAFSYS 302

  Fly   198 ----HKGMPFSTF--DHDDTGHG-CARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--RGIT 253
                |.|..|||:  |||....| |||.|...||:|.|..:||||::..|     :.||  .||.
Zfish   303 KQYNHDGRAFSTYDRDHDRYAAGNCARYYGAGWWFDSCLAANLNGRFYHG-----RYSGITDGIY 362

  Fly   254 WMSW-------RGYDYGYKFVQMMIRPKCS 276
            |.:|       .|..|.:|.|:|..||:.|
Zfish   363 WGTWYILTEYRTGERYSFKSVEMKTRPRRS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/240 (35%)
si:ch211-157b11.8XP_009300879.1 FReD 165..390 CDD:238040 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.