DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fcn2l

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_004917606.2 Gene:fcn2l / 101735093 XenbaseID:XB-GENE-22167163 Length:301 Species:Xenopus tropicalis


Alignment Length:197 Identity:81/197 - (41%)
Similarity:109/197 - (55%) Gaps:5/197 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFL 143
            ::|...|::|..|.||....|.||.|.|||.|||.:|:|.|:.|..|||....||::|.:.||.|
 Frog   107 YIIYPDGVQPMKVLCDMHTDGGGWIVFQRRWDGSVDFFRDWKSYKSGFGSRLNEFWLGNDNLHKL 171

  Fly   144 TTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHKGMPFSTFDH 208
            |::..:||.|.::||....|.|:||.|.|...|..:.|.:.....|:..|:::.|..|||||.|.
 Frog   172 TSSGTWELRVDLQDFENAKHFAKYESFRILGESEKFKLLIGAMKGGNIEDAMKVHNTMPFSTKDQ 236

  Fly   209 DD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMI 271
            |:  ....||..|.|.|||:.|..|||||.||.|..   ..:..||.|...||::|.||..:|.|
 Frog   237 DNDILPEHCADRYKGGWWYNGCHHSNLNGLYLLGSH---SNTAEGINWYGGRGHNYSYKRSEMKI 298

  Fly   272 RP 273
            ||
 Frog   299 RP 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 81/197 (41%)
fcn2lXP_004917606.2 Collagen 38..>79 CDD:396114
FReD 91..300 CDD:238040 79/195 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.