DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC101731636

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_031748199.1 Gene:LOC101731636 / 101731636 -ID:- Length:241 Species:Xenopus tropicalis


Alignment Length:214 Identity:88/214 - (41%)
Similarity:112/214 - (52%) Gaps:7/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGE 128
            |....|..|...:|.:.|..|......|.||....|.||.|.|||.|||.:|||.|..|.:|||.
 Frog    31 NCKEWLDQGGTISGWYTIYTPNELFLSVLCDMETDGGGWIVFQRRADGSVDFYRDWNSYKRGFGR 95

  Fly   129 LSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYS-GDAG 192
            ...||::|.:.||.||....::|.|.:.||:.....|.|.:|.|...:.:|.|. .|.|: ||||
 Frog    96 KESEFWLGNDNLHLLTATGNFQLRVDLTDFSEQRTYAAYSNFRIAGEAQNYTLH-FGVYTGGDAG 159

  Fly   193 DSLRYHKGMPFSTFDHD-DTGHG-CARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWM 255
            |||..|.|..|||.|.| |..:| ||::|.|||||..|..|||||.||.|   :......|:.|.
 Frog   160 DSLSEHNGFRFSTKDRDNDVYNGNCAQLYKGAWWYTSCHTSNLNGLYLRG---DHTSYANGVNWS 221

  Fly   256 SWRGYDYGYKFVQMMIRPK 274
            :.:|..|.||..:|..||:
 Frog   222 AGKGPHYSYKVSEMKFRPQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/212 (41%)
LOC101731636XP_031748199.1 FReD 30..239 CDD:238040 86/211 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.