DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and mfap4.11

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_003197842.1 Gene:mfap4.11 / 100538113 ZFINID:ZDB-GENE-121214-183 Length:244 Species:Danio rerio


Alignment Length:220 Identity:83/220 - (37%)
Similarity:112/220 - (50%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAG-----SGWTVIQRRQDGSENFYRCWEEYSQG 125
            |....:|...:|::.|...|..|..|||.....|     .||||.|||.||..|||:.||.|.:|
Zfish    28 SEIYKSGQTVSGVYSIYPAGDTPVWVYCQMISDGKDEENGGWTVFQRRMDGRINFYQPWEVYKRG 92

  Fly   126 FGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGD 190
            ||...||:::|||.|:.||..:.:.|.|.:|||.|....|:|..|::|:.:..|.|.|.|...|.
Zfish    93 FGTTEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRKVFAQYSSFSVGSEAEGYKLQVSGFTDGG 157

  Fly   191 AGDSLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYD-QCQRSNLNGQYLEG---GRFEPKMSG 249
            |||||..|....|||.|.|...:  .|||.::|.:||. .|..:|.||.||.|   .|:     .
Zfish   158 AGDSLSAHNDRKFSTLDKDQDLYEKNCARYFLGGFWYTVGCHYTNPNGMYLWGEHNTRY-----A 217

  Fly   250 RGITWMSWR-GYDYGYKFVQMMIRP 273
            .|:.|.:|: .:....|...|.|:|
Zfish   218 IGVVWSTWKNSFTLSMKTFLMKIKP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 83/220 (38%)
mfap4.11XP_003197842.1 FReD 24..243 CDD:238040 83/220 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm6355
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.710

Return to query results.
Submit another query.