DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC100496945

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_002935082.1 Gene:LOC100496945 / 100496945 -ID:- Length:306 Species:Xenopus tropicalis


Alignment Length:224 Identity:88/224 - (39%)
Similarity:119/224 - (53%) Gaps:9/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ERGSHETI----NPSSCLAAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFY 116
            :||:.:.:    |....|..|...:|.:.|...|..|..|.||....|.||.|.||..|||.:|:
 Frog    87 DRGAPDQLYAARNCKELLDQGAILSGWYKIYPDGERPLTVLCDMDTDGGGWIVFQRTWDGSVDFF 151

  Fly   117 RCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYAL 181
            |.|:.|.:|||....||::|.:.:|.||::..|:|.:...||......|.|:.||.......|.|
 Frog   152 RDWDSYKKGFGSQLSEFWLGNDNIHTLTSSGTYQLRIDFTDFENQNSFAAYDSFATLGEKDHYQL 216

  Fly   182 SVLGKYS-GDAGDSLRYHKGMPFSTFDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEP 245
             :||.|| |.|||||.:|:..||||.|:|..|:.||..:.|.|||..|..:||||.||.|   :.
 Frog   217 -ILGAYSGGTAGDSLNHHRNCPFSTKDNDLHGNNCAETFKGGWWYGSCHDANLNGLYLRG---KH 277

  Fly   246 KMSGRGITWMSWRGYDYGYKFVQMMIRPK 274
            ...|.||.|.:.:|.:|.||..:|..|||
 Frog   278 SNDGLGINWETGKGNNYSYKVTEMKFRPK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/215 (39%)
LOC100496945XP_002935082.1 Collagen 41..91 CDD:189968 2/3 (67%)
FReD 98..306 CDD:238040 84/211 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.