DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC100496532

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_031746600.1 Gene:LOC100496532 / 100496532 -ID:- Length:349 Species:Xenopus tropicalis


Alignment Length:246 Identity:94/246 - (38%)
Similarity:125/246 - (50%) Gaps:23/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QSYKEITEERGSHETINP------------SSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRL 97
            |....|...||....|.|            .:|   |..|....|.:.:...|.:|..|.||...
 Frog   107 QGIPGILGPRGEKGDIGPPGPWGPPGVKASKNCMELLNNGATLTGWYTVYPDGNKPINVLCDMDT 171

  Fly    98 AGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVV 162
            .|.||.|.|||.|||.:|||.|:.|.||||...|||::|.|.:|.||::..::|...:|||:...
 Frog   172 DGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQLGEFWLGNENIHLLTSSGNFQLRFDLEDFDNNR 236

  Fly   163 HDARYEDFAIGNASASYALSVLGKYS-GDAGDSLRYHKGMPFSTFDHD-DTGH--GCARIYVGAW 223
            ..|.|..|.:...|..|.|. .|::: |.|||||..||...|||.|.| ||.:  .||.:|||||
 Frog   237 TYATYSQFRLEPESQKYTLR-FGEFTGGPAGDSLGPHKNRAFSTKDADNDTANDSSCAVLYVGAW 300

  Fly   224 WYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRPK 274
            ||..|..|:|||:||.|   :....|.|:.|.::||.:|..|..::..||:
 Frog   301 WYSSCHNSSLNGEYLRG---KHSKRGSGVLWHNFRGIEYSLKVSEIKFRPQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 89/229 (39%)
LOC100496532XP_031746600.1 Collagen 50..89 CDD:396114
FReD 134..347 CDD:238040 86/216 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.