DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC100496379

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_031746585.1 Gene:LOC100496379 / 100496379 -ID:- Length:490 Species:Xenopus tropicalis


Alignment Length:229 Identity:86/229 - (37%)
Similarity:119/229 - (51%) Gaps:17/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ERGSHETINPS--SCL---AAGINSNGIHVIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENF 115
            |:|......|:  :|:   ..|:..:|.:.|...|.:|..|.||....|.||.|.|:|.|||.:|
 Frog   267 EKGESRVWYPAVKNCMELRTYGVLFSGWYTIYPDGNKPLNVLCDMHTDGGGWIVFQKRMDGSVDF 331

  Fly   116 YRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYA 180
            ||.|..|.||||....||::|.|.:|.||::...:|.:.:|||:.....|.|..|.:...|..|.
 Frog   332 YRDWGSYRQGFGSQLSEFWLGNENIHRLTSSGNIQLRIDLEDFDNNRTYATYSQFRLEPESQKYT 396

  Fly   181 LSVLGKYS-GDAGDSLRYHKGMPFSTFDHD---DTGHGCARIYVGAWWYDQCQRSNLNGQYLEG- 240
            |. ||.:: |.|||||..|....|::.|.|   .....||..|.|||||.:|..:.|||:||.| 
 Frog   397 LR-LGAFTGGTAGDSLSSHNNKAFASKDADYDESVNSNCAEKYKGAWWYVKCYDACLNGEYLRGP 460

  Fly   241 -GRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRP 273
             |:     :..||.|.::|||:|..|..:|..||
 Frog   461 LGQ-----NYGGIAWKTFRGYNYSLKKSEMKFRP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/222 (38%)
LOC100496379XP_031746585.1 Collagen 91..144 CDD:396114
Collagen <213..270 CDD:396114 1/2 (50%)
FReD 276..490 CDD:238040 84/220 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 1 1.000 - - mtm14088
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.