DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angptl5

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_031752234.1 Gene:angptl5 / 100493165 XenbaseID:XB-GENE-479274 Length:347 Species:Xenopus tropicalis


Alignment Length:225 Identity:77/225 - (34%)
Similarity:120/225 - (53%) Gaps:27/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NGIHVIEVPG-LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEK 139
            :|:::|:..| ..||..:||....|.||||||:|.|||.:|.|.|.:|.:|||:|||||::||:|
 Frog   124 SGLYIIQPEGTYYPFEAFCDMDYQGGGWTVIQKRIDGSVDFQRSWIDYMEGFGDLSGEFWLGLKK 188

  Fly   140 LHFLTTAE--PYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRYHK--- 199
            ...:...:  .:.|.:.:|..:|.:..|.|:.|.:.:.|..:.:.| |:|||.|||:||..|   
 Frog   189 TFCILNQKNTSFMLSIALEAEDGTLAYASYDSFWLEDESNQFIMHV-GRYSGTAGDALRGFKKED 252

  Fly   200 ---GMPFSTFDHDD-------TGHG-----CARI-YVGAWWYDQCQRSNLNGQYLEGGRFEPKMS 248
               .|||||||.|:       |.:|     |:.: ....||:.||..:||||.:    :....:.
 Frog   253 NQNAMPFSTFDADNDRCNPSCTVNGKSINSCSLLNNRSGWWFSQCGLANLNGVH----KVTRLVD 313

  Fly   249 GRGITWMSWRGYDYGYKFVQMMIRPKCSNN 278
            ..||.|.:|:......|...:.::.|.:.|
 Frog   314 ISGIHWNTWKEDKENVKIKSVSMKIKRTYN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 75/219 (34%)
angptl5XP_031752234.1 FReD 108..340 CDD:238040 75/220 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.