DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and angpt1

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_002938959.2 Gene:angpt1 / 100492672 XenbaseID:XB-GENE-488130 Length:504 Species:Xenopus tropicalis


Alignment Length:264 Identity:101/264 - (38%)
Similarity:145/264 - (54%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 STAQSNKLDLVYKKAESMVSSLKIRLEE---LKQSYKEITEERGSHETINPSSCLAAGINSNGIH 79
            |..|..:|:|:    |::.:.:|:..:|   ||...||  ||:...:.   |....||.|.:|::
 Frog   251 SILQKQQLELM----ETVHNLVKLCSKEGVTLKNVKKE--EEKPFRDC---SDLFHAGFNKSGVY 306

  Fly    80 VIEVPGL-EPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFL 143
            .|.:..: ||..|||:...||.||||||.|:|||.:|.|.|::|..|||..||||::|.|.:..|
 Frog   307 TIYINNVSEPKKVYCNMDTAGGGWTVIQHREDGSVDFQRGWKDYKVGFGSPSGEFWLGNEFIFAL 371

  Fly   144 TTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG--DSLRYHKGMPFST- 205
            |:...|.|.:.:.|:.|....::|:.|.|||...:|.|.:.| :||.||  .||..| |..||| 
 Frog   372 TSQRQYSLRIDLTDWEGNHAHSQYDRFHIGNEKQNYRLYLKG-HSGTAGKQSSLILH-GADFSTK 434

  Fly   206 -FDHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQM 269
             .|:|:....||.:..|.||:|.|..|||||.|...|:...|::  ||.|..::|..|..:...|
 Frog   435 DADNDNCMCKCALMLTGGWWFDACGPSNLNGMYYTAGQNHGKLN--GIKWHYFKGPSYSLRATTM 497

  Fly   270 MIRP 273
            ||||
 Frog   498 MIRP 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 88/216 (41%)
angpt1XP_002938959.2 Smc <73..298 CDD:224117 14/55 (25%)
FReD 287..502 CDD:238040 88/222 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48348
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.