DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and mfap4.2

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_012826893.1 Gene:mfap4.2 / 100488329 XenbaseID:XB-GENE-22167947 Length:261 Species:Xenopus tropicalis


Alignment Length:229 Identity:90/229 - (39%)
Similarity:120/229 - (52%) Gaps:18/229 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PSSC---LAAGINSNGIHVIEVPG-LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQG 125
            |:.|   .|.|...:|:::|...| ....|||||.....:.|||||:|.|||.:|.|.|.:|..|
 Frog    34 PADCEDVYALGSKEDGVYIIYPAGSSSALPVYCDMTTDEAKWTVIQKRFDGSLSFSRGWTDYKLG 98

  Fly   126 FGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDF-----AIGNASASYALSVLG 185
            ||....|:::||..::.||..:.|.|.:.:.||......|.|.||     ||......|.|.|.|
 Frog    99 FGRADEEYWLGLHNIYQLTLQKKYMLRIELGDFENNTAHAEYTDFSLSPNAINPEDDGYTLFVDG 163

  Fly   186 KYSGDAGDSLRYHKGMPFSTFDHD-DT-GHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMS 248
            ...|.|||||.:|.||.||||||| || ...||.:|...:|:..|..:|:||.||:...:  ..|
 Frog   164 FIDGGAGDSLTFHNGMKFSTFDHDQDTYQQNCAFLYSSGFWFKGCHLANINGPYLQDATY--TSS 226

  Fly   249 GRGITWMSWRGYDYGYKFVQMMIR-----PKCSN 277
            |.||||..|:|::|..|..::.||     ..|||
 Frog   227 GNGITWTRWKGFNYSLKTTEIKIRRVEMCQNCSN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/224 (39%)
mfap4.2XP_012826893.1 FReD 32..252 CDD:238040 87/219 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.