DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC100334800

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:232 Identity:87/232 - (37%)
Similarity:115/232 - (49%) Gaps:22/232 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RGSHETINPSSCLAAGINSNG-----IHVIEVPGLEPFPVYCDTRLAG-----SGWTVIQRRQDG 111
            |.||.......|..:.::.:|     .|.:.:.. .|..|.|.....|     .||||||:|.||
Zfish    18 RDSHPDYRSRPCDCSDLHRSGERSSRTHTVYIDD-SPINVDCHMISEGREDEHGGWTVIQKRMDG 81

  Fly   112 SENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNAS 176
            |.||||.|:||.:|||...||.::|||.:|.:|..:.|.|.|.:|||.|....|.|..|::....
Zfish    82 SLNFYRPWKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAHYSSFSVDCEE 146

  Fly   177 ASYALSVLGKYSGDAGDSLRYHKGMPFSTF--DHDDTGHGCARIYVGAWWYDQCQRSNLNGQYLE 239
            ..|.|.|.|...|.|||||..|....||||  |.||....|||.::|.:||.:|..:|.||.||.
Zfish   147 DGYKLHVSGFRDGGAGDSLSSHNNQKFSTFDKDQDDYKKNCAREFLGGFWYKKCHHANPNGVYLW 211

  Fly   240 GGRFEPKMSGRGITWMSWRGYDYGY----KFVQMMIR 272
            |  .:......|:.|.||   |:.|    |::.|.|:
Zfish   212 G--HDRTHYAIGVCWWSW---DHNYYNSLKYISMKIK 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/226 (37%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 84/222 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.