DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and XB5954422

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001120041.1 Gene:XB5954422 / 100145014 XenbaseID:XB-GENE-5954423 Length:365 Species:Xenopus tropicalis


Alignment Length:241 Identity:90/241 - (37%)
Similarity:125/241 - (51%) Gaps:18/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QSYKEITEERGSHETINPS--------SCL---AAGINSNGIHVIEVPGLEPFPVYCDTRLAGSG 101
            :.|:....|:|.......|        :|:   .:|:...|.:.|...|.:|..|.||....|.|
 Frog   128 KGYQGTKGEKGDQGAKGASGLGYKAARNCMELRESGLVFTGWYTIYPDGNKPLVVLCDMDTDGGG 192

  Fly   102 WTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDAR 166
            |.|.|||||||.:|||.|:.|.||||....||::|.|.:|.||::..::|...:|||:.....|.
 Frog   193 WIVFQRRQDGSVDFYRDWKSYKQGFGSQQSEFWLGNENIHLLTSSGNFQLRFDLEDFDNNRTYAT 257

  Fly   167 YEDFAIGNASASYALSVLGKYS-GDAGDSLRYHKGMPFSTFD-HDDTG-HGCARIYVGAWWYDQC 228
            |..|.:...|..|.|. .|::: |.|||||..|:.:||||.. |::.| ..||..|.|||||.:|
 Frog   258 YSQFRLEGESQKYTLR-FGEFTGGTAGDSLSTHRNLPFSTKGVHNNAGTANCAETYKGAWWYSRC 321

  Fly   229 QRSNLNGQYLEGGRFEPKMSGRGITWMSWRGYDYGYKFVQMMIRPK 274
            ..|.|||:|..|.  ....|| |:.|.::||..|..|..:|..||:
 Frog   322 YSSCLNGEYRRGA--HDSKSG-GVHWNTFRGVSYSLKVSEMKFRPE 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 86/224 (38%)
XB5954422NP_001120041.1 Collagen 45..102 CDD:189968
Collagen 84..142 CDD:189968 3/13 (23%)
FReD 154..363 CDD:238040 84/212 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1035379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.