DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and tnr

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001107287.1 Gene:tnr / 100135076 XenbaseID:XB-GENE-948286 Length:1350 Species:Xenopus tropicalis


Alignment Length:290 Identity:103/290 - (35%)
Similarity:149/290 - (51%) Gaps:39/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVYKKAESMVSSL-------KIRLEELKQSYKE----ITEERGSHETIN-------------PSS 67
            |.||.|......|       .||||.|.:|.:.    ::.:.|...::.             |..
 Frog  1068 LTYKSANESRKELIVDAEDTWIRLEGLLESTEYTVSILSVQNGERSSVTHTVFTTGGRVFSYPQD 1132

  Fly    68 C---LAAGINSNGIHVIEVPG--LEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFG 127
            |   :..|.|.:|::.|.:.|  .:..|||||......||.|.||||:|..:|:|.|.:|..|||
 Frog  1133 CAQHMLNGDNQSGVYYIYINGDMSQSVPVYCDMATDAGGWIVFQRRQNGLTDFFRKWADYRVGFG 1197

  Fly   128 ELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAG 192
            .|..||::||:.||.:|:...|||.:.|.|....|: |.|..|.||:|.:.|.|.: |.::|.:|
 Frog  1198 NLEDEFWLGLDTLHQVTSQGRYELRIDMRDGQEAVY-AYYNKFNIGDARSLYKLRI-GDFNGTSG 1260

  Fly   193 DSLRYHKGMPFSTFDHDD--TGHGCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSGRGITWM 255
            |||.||:|.||||.|.|:  ....||..|.|||||..|.|:||||:|.|      ....:||.|.
 Frog  1261 DSLTYHQGRPFSTKDRDNDVAVTNCASSYKGAWWYKNCHRTNLNGKYGE------SRHSQGINWY 1319

  Fly   256 SWRGYDYGYKFVQMMIRPKCSNNLRRQGMQ 285
            .|:|:::...||:|.:||.....::::.:|
 Frog  1320 HWKGHEFSIPFVEMKMRPYNHRTMKKRSLQ 1349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 89/230 (39%)
tnrNP_001107287.1 EGF_alliinase 153..196 CDD:282688
EGF_2 198..223 CDD:285248
EGF_2 260..285 CDD:285248
EGF_2 292..316 CDD:285248
FN3 321..410 CDD:238020
fn3 413..493 CDD:278470
fn3 502..582 CDD:278470
FN3 592..676 CDD:238020
fn3 684..763 CDD:278470
fn3 773..840 CDD:278470
fn3 862..939 CDD:278470
fn3 949..1018 CDD:278470
FN3 1037..1122 CDD:238020 12/53 (23%)
FReD 1129..1337 CDD:238040 88/215 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3392
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9330
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.