DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and mfap4.4

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001103327.2 Gene:mfap4.4 / 100126131 ZFINID:ZDB-GENE-071004-9 Length:242 Species:Danio rerio


Alignment Length:213 Identity:87/213 - (40%)
Similarity:116/213 - (54%) Gaps:16/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AGINSNGIHVIEVPGLEPFPVYCDTRLAG-----SGWTVIQRRQDGSENFYRCWEEYSQGFGELS 130
            :|...:|.:.|...|..|..|||.....|     .||||||||.|||.||||.|.:|.:|||.:.
Zfish    32 SGETLSGAYTIYPAGDSPVWVYCQMVSEGKDEDNGGWTVIQRRMDGSVNFYRPWRDYKRGFGNVE 96

  Fly   131 GEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSL 195
            ||:::|||.|:.||..:.:.|.|.:|||.|....|:|..|::|.....|.|.|.|...|.||||:
Zfish    97 GEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSGFTDGGAGDSM 161

  Fly   196 RYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYL---EGGRFEPKMSGRGITWM 255
            ..|..|.|||||.|...:  .||:.|:||:||..|..:|.||.||   :...|     ..|:||.
Zfish   162 TPHNEMKFSTFDKDQDTYEKNCAKEYLGAFWYGYCHNTNPNGVYLWEDDSTHF-----AIGVTWY 221

  Fly   256 SWRG-YDYGYKFVQMMIR 272
            ||:. :|...|::.|.|:
Zfish   222 SWKNTHDMSLKYISMKIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 87/213 (41%)
mfap4.4NP_001103327.2 FReD 25..239 CDD:238040 86/211 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.