DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fga

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_002933535.3 Gene:fga / 100038060 XenbaseID:XB-GENE-478771 Length:761 Species:Xenopus tropicalis


Alignment Length:245 Identity:87/245 - (35%)
Similarity:126/245 - (51%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KEITEERGSHETINPSSCLAAGINSNGIHVIEVPG-LEPFPVYCDTRLAGSGWTVIQRRQDGSEN 114
            |:..:.|..|         ::|..| ||..|...| .:...||||......||.:||:|||||.|
 Frog   525 KDCDDIRQKH---------SSGAKS-GIFKIRPEGSTKVLSVYCDQDTQLGGWILIQQRQDGSVN 579

  Fly   115 FYRCWEEYSQGFGEL----SGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNA 175
            |.|.|::|..|||.:    .||.::|.|.:|.||..:.. |.:.:||::|....|.| :..:|:.
 Frog   580 FNRTWQDYKNGFGSVDAGGKGEVWLGNENIHLLTQKDTI-LRIELEDWSGEKVYAEY-NIQLGSE 642

  Fly   176 SASYALSVLGKYSGDAGDSL--------RY--HKGMPFSTFDHDDT--GHGCARIYVGAWWYDQC 228
            :..:.|.| .:|.|.|||:|        .|  |..|.|||:|.|..  ...||.:|.|.|||:.|
 Frog   643 AEGFTLKV-SQYEGTAGDALIEGSKEDGEYTSHINMKFSTYDRDSDKWEENCAEMYGGGWWYNNC 706

  Fly   229 QRSNLNGQYLEGGRFEPKMS-----GRGITWMSWRGYDYGYKFVQMMIRP 273
            |.|||||.|..||:::|:.:     ..|:.|:.::..||..|.|:|.:||
 Frog   707 QASNLNGIYYIGGQYDPRNNFPYEIENGVVWVPFKAADYSLKTVRMKMRP 756

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 84/233 (36%)
fgaXP_002933535.3 Fib_alpha 51..191 CDD:400857
Fibrinogen_aC 299..372 CDD:403400
FReD 523..757 CDD:238040 87/245 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.