DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and LOC100007488

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:224 Identity:91/224 - (40%)
Similarity:118/224 - (52%) Gaps:12/224 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SHETINPSSC---LAAGINSNGIHVIEVPGLEPFPVYCDTRLAG-----SGWTVIQRRQDGSENF 115
            ||....|..|   ..:|.|.:||:.|...|..|..|||.....|     .||||||||.|||.||
Zfish    21 SHSVDKPFDCSDIYKSGQNLSGIYSIYPAGDFPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNF 85

  Fly   116 YRCWEEYSQGFGELSGEFFMGLEKLHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYA 180
            ||.|.:|.:|||::.||:::|||.|:.||..:.:.|.|.:|||.|....|:|..|::|.....|.
Zfish    86 YRPWRDYKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYK 150

  Fly   181 LSVLGKYSGDAGDSLRYHKGMPFSTFDHDDTGH--GCARIYVGAWWYDQCQRSNLNGQYLEGGRF 243
            |.|.|...|.|||.|..|..:.|||||.|...|  .||:.|:|.:||..|..:|.||.||.|.  
Zfish   151 LQVSGFTDGGAGDCLSGHNDLKFSTFDKDQDTHEKSCAKEYLGGFWYGSCHNTNPNGVYLWGE-- 213

  Fly   244 EPKMSGRGITWMSWRGYDYGYKFVQMMIR 272
            :|.....|:.|.:|:.|....|...|.|:
Zfish   214 DPTHYAIGVCWSTWKNYAVSMKTFSMKIK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 89/220 (40%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 89/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 190 1.000 Domainoid score I3199
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000029
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X25
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.