DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30281 and fgl2b

DIOPT Version :9

Sequence 1:NP_726164.1 Gene:CG30281 / 246525 FlyBaseID:FBgn0050281 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_001341185.5 Gene:fgl2b / 100001116 ZFINID:ZDB-GENE-120709-53 Length:1447 Species:Danio rerio


Alignment Length:218 Identity:86/218 - (39%)
Similarity:121/218 - (55%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NGIH-VIEVPGLEPFPVYCDTRLAGSGWTVIQRRQDGSENFYRCWEEYSQGFGELSGEFFMGLEK 139
            ||:: |...|....|||:||...:|.|||:||.|.|||.:|.|.|:||..|||:|.|||::|.:|
Zfish  1231 NGVYRVTPRPKNTTFPVFCDMASSGGGWTLIQHRFDGSTSFNRTWDEYKNGFGKLIGEFWLGNDK 1295

  Fly   140 LHFLTTAEPYELFVYMEDFNGVVHDARYEDFAIGNASASYALSVLGKYSGDAGDSLRY-----HK 199
            :|.||.|:...|.:.:|||.|:...|:|:.|.|.|.|..|.||:.| |||.||:::::     |.
Zfish  1296 IHLLTKAKNMSLRIEIEDFEGIREYAQYDHFYIANESQQYRLSIDG-YSGTAGNAMQFSKKYNHD 1359

  Fly   200 GMPFSTFDHDDTGH---GCARIYVGAWWYDQCQRSNLNGQYLEGGRFEPKMSG--RGITWMSWRG 259
            ...|:|.|.|:..:   .|...|...||:|.|..:||||:|     ::.|..|  .||.|.:|..
Zfish  1360 QKFFTTPDRDNDQYPSGNCGAYYSSGWWFDACMSANLNGKY-----YQSKYKGVRNGIFWGTWHN 1419

  Fly   260 YDYGY---------KFVQMMIRP 273
            ....|         :.|:|||||
Zfish  1420 ITMEYYPTNERQSFRTVRMMIRP 1442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30281NP_726164.1 FReD 63..274 CDD:238040 86/218 (39%)
fgl2bXP_001341185.5 FReD 1219..1442 CDD:238040 84/216 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.