DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco6c1

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_083218.1 Gene:Slco6c1 / 74441 MGIID:1921691 Length:706 Species:Mus musculus


Alignment Length:39 Identity:7/39 - (17%)
Similarity:16/39 - (41%) Gaps:6/39 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 PTYKHSVILDNNTIVGRCFPMKFQLRRTKKNCLDCGNEL 166
            |.:.:.:|:.....:..|      :...:|..:.|||.:
Mouse   180 PFFTYEIIIPGRQSIELC------MEENEKRNIICGNSV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
Slco6c1NP_083218.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
MFS_SLCO6_OATP6 93..594 CDD:340963 7/39 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.