DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and SLCO1A2

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_066580.1 Gene:SLCO1A2 / 6579 HGNCID:10956 Length:670 Species:Homo sapiens


Alignment Length:85 Identity:18/85 - (21%)
Similarity:34/85 - (40%) Gaps:18/85 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 LDNNTIVGRCFPMKFQLRRTKKNCLDCGNE---LYYRYPITNNSDLLLIKNCCEVEVYPAKKVEN 197
            |.:|:.:  |.....|:.|..::..:|..|   |.:.|.:..|    :::...|..:.|      
Human   125 LSSNSFL--CMENGTQILRPTQDPSECTKEVKSLMWVYVLVGN----IVRGMGETPILP------ 177

  Fly   198 MNNVRVTKISGVKKFANSLL 217
               :.::.|....||.||.|
Human   178 ---LGISYIEDFAKFENSPL 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
SLCO1A2NP_066580.1 oat 1..625 CDD:273279 18/85 (21%)

Return to query results.
Submit another query.