DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco1b2

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_113838.1 Gene:Slco1b2 / 58978 RGDID:69300 Length:687 Species:Rattus norvegicus


Alignment Length:265 Identity:51/265 - (19%)
Similarity:88/265 - (33%) Gaps:93/265 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DG--PVRQEINIRAECSKGRPLLESDKDKLRCCTMCVAQEQNLHP----------NLCSAQCRPL 111
            ||  ||...|::        ||...:.|       |...:....|          :.|.|.|:..
  Rat   440 DGMNPVDSHIDV--------PLSYCNSD-------CSCDKNQWEPICGENGVTYISPCLAGCKSF 489

  Fly   112 KTYLHLNEWTKRPLPKPTYKHSVIL---DNNTIVGRCFPMKFQLRRTKKNCLDCGNELYYRYPI- 172
            :       ..|:|.....|..|.|.   :|:..:|.|...|     .|.|        ||.|.| 
  Rat   490 R-------GDKKPNNTEFYDCSCISNSGNNSAHLGECPRYK-----CKTN--------YYFYIIL 534

  Fly   173 -----------TNNSDLLLIKNCCEVEVYPAKK--VENMNNVRVTKISGVK-------------- 210
                       :.:..|:|:|:     |.|..|  ....:::.:..:.|:.              
  Rat   535 QVTVSFFTAMGSPSLILILMKS-----VQPELKSLAMGFHSLIIRALGGILAPIYYGAFIDRTCI 594

  Fly   211 KFANSLLKEHSECRLFT--------LASQLAKQKPPLAPDVRMSRMSRK--SRKSRKSRKSSRKS 265
            |::.:...:...|||:.        |...||.:.|||...|.:...:::  .|...|:.::.|:.
  Rat   595 KWSVTSCGKRGACRLYNSRLFGFSYLGLNLALKTPPLFLYVVLIYFTKRKYKRNDNKTLENGRQF 659

  Fly   266 SLFGN 270
            :..||
  Rat   660 TDEGN 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco1b2NP_113838.1 MFS 28..555 CDD:421695 30/149 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..311
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.