DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and slco3a1a

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001038653.1 Gene:slco3a1a / 569735 ZFINID:ZDB-GENE-030131-8662 Length:701 Species:Danio rerio


Alignment Length:74 Identity:17/74 - (22%)
Similarity:29/74 - (39%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QNLHPNLCSAQ-CRPLKTYLHLNEWTKRPLPKPTY---------KHSVILDNNTIVGRCFPMKFQ 151
            ||..||..|.. |:.|:.   :.:.||..|..|.:         :.:|:......:|:....:|.
Zfish   303 QNYQPNSNSLSCCQQLRV---IPKVTKHLLSNPVFTCIVLAACMEIAVVAGFAAFLGKYLEQQFN 364

  Fly   152 LRRTKKNCL 160
            |..:..|.|
Zfish   365 LTTSSANQL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
slco3a1aNP_001038653.1 OATP 29..614 CDD:281175 17/74 (23%)
MFS 35..>265 CDD:119392
KAZAL_SLC21 449..506 CDD:238650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.