DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco4c1

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001002024.2 Gene:Slco4c1 / 432363 RGDID:1303048 Length:724 Species:Rattus norvegicus


Alignment Length:78 Identity:18/78 - (23%)
Similarity:24/78 - (30%) Gaps:32/78 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SPPAADLPEPQAEVVKAVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMCVAQEQNLHPN 102
            |||::.||        |..||.|....|:. ...|.                      .:|.||.
  Rat    59 SPPSSTLP--------ASDEPPGSQLSELE-EGPCG----------------------WRNFHPQ 92

  Fly   103 LCSAQCRPLKTYL 115
             |..:|...|.:|
  Rat    93 -CLQRCNNPKGFL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco4c1NP_001002024.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81 10/30 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.