DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Oatp58Da

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_611657.2 Gene:Oatp58Da / 37543 FlyBaseID:FBgn0050277 Length:684 Species:Drosophila melanogaster


Alignment Length:173 Identity:38/173 - (21%)
Similarity:49/173 - (28%) Gaps:73/173 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DKLRCCTMCVAQEQNLHPNLCSAQCRPLKTYLHLNEWTKRPLPKPTYKHSVILDNNTIVGRCFP- 147
            |:|...|...|      .|.|||.|.  ..|:|             |......||.|.:..|.. 
  Fly   450 DRLNTLTTLSA------GNSCSASCH--CDYVH-------------YAPVCSADNITFISACHAG 493

  Fly   148 ----MKFQLRR---TKKNCL---------------------DCGNELYYRYPI----------TN 174
                .|..|.|   |...||                     ||.||......:          :.
  Fly   494 CSERTKDALGRTIYTGCECLGSSSLNSEPESQFAVDGTCPVDCFNEFLIFLGVMCFLKLVGASSK 558

  Fly   175 NSDLLLIKNCCEVEVYPAKKVENMNNVRVTKISGVKKFANSLL 217
            :::|||...|    :.|.:|         |...|:...|.|||
  Fly   559 STNLLLALRC----MPPDEK---------TFALGLGSMAASLL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Oatp58DaNP_611657.2 OATP 67..626 CDD:281175 38/173 (22%)
MFS 69..>425 CDD:119392
KAZAL_SLC21 462..514 CDD:238650 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.