DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and CG4286

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_611560.1 Gene:CG4286 / 37416 FlyBaseID:FBgn0034601 Length:219 Species:Drosophila melanogaster


Alignment Length:200 Identity:56/200 - (28%)
Similarity:90/200 - (45%) Gaps:35/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 VVKAVIEPDGPVRQEINIR----AEC-SKGR----PLLESDKDK----------------LRCCT 90
            |:|..::.|..:::.|:|.    .|| .:|:    |..:.|.|.                ..|.|
  Fly    24 VIKNFLKRDCAIKKLIDIEEEFLQECVLRGQDPMNPKGKRDSDSGPHGSGLGSNVPEPKPDPCAT 88

  Fly    91 MCVAQEQNLHPNLCSAQCRPLKTYLHLNEWTKRPLPKPTYKHSV--ILDNNTIVGRCFPMKFQLR 153
            .  ..|..|..:.|. .||.|||.:.|.|.||..:..|.:..|:  ..|..:::|...|:||:.|
  Fly    89 K--TPENTLASDYCD-PCRRLKTSVVLEELTKPAITNPAFNKSLPPYFDEESVMGNSLPVKFRFR 150

  Fly   154 RTKKNC--LDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNVRVTKISGVKKFANSL 216
            |....|  ...||.:....|.||   ::::.|||:|.|:|:::|..||.|.||.:||.......:
  Fly   151 RKFNKCDQEKAGNLMCTNTPSTN---VVVLTNCCDVMVWPSQRVAQMNRVPVTMLSGEADLTEYM 212

  Fly   217 LKEHS 221
            |:|.:
  Fly   213 LEEET 217



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454085
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019673
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.