DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Oatp33Eb

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609570.1 Gene:Oatp33Eb / 34662 FlyBaseID:FBgn0032435 Length:814 Species:Drosophila melanogaster


Alignment Length:87 Identity:21/87 - (24%)
Similarity:34/87 - (39%) Gaps:24/87 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VSPPAADLPEPQAEVVKAVIEP---------DGPVRQEI-NIRAECSKGRPLLESDK--DKLRCC 89
            |.||....|:..:...|.:..|         :..||.:: |::   |...|..|:|:  |.:...
  Fly   714 VFPPDRRKPDDGSTSPKRLAVPANVPLHLLSESDVRSQLGNLK---SFNPPKQEADRGLDTVDTD 775

  Fly    90 TMCVAQEQ---------NLHPN 102
            .:.|.|.|         :||||
  Fly   776 DVVVTQPQVQAVLPITRDLHPN 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Oatp33EbNP_609570.1 oat 23..619 CDD:273279
MFS 50..>267 CDD:119392
KAZAL_SLC21 430..483 CDD:238650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.