DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Oatp30B

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_609293.2 Gene:Oatp30B / 34268 FlyBaseID:FBgn0032123 Length:1197 Species:Drosophila melanogaster


Alignment Length:281 Identity:55/281 - (19%)
Similarity:97/281 - (34%) Gaps:70/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 CFESTCGPCIDYRVSPPAADLPEPQAEVVKAVIEPDGPVRQ-EINIRAECSKGRPLLESDKDKLR 87
            |::. ||     ||..||....:||.:..|........|:. :...|...|...|...:.:|.:.
  Fly   915 CYDK-CG-----RVVTPANTCNQPQTKSKKHFRSASCDVKMIKSFARDHSSSSGPADAAGQDAVG 973

  Fly    88 CCTMCVAQEQNLHPNLCSAQCRPLKTYLH---------LNEWTKRPLPKPTYKHSVILDNNTIVG 143
            ..|    :.:||  ....|..|...|.||         .|:...:..|:..       |:..:..
  Fly   974 AST----KYKNL--KKFQAHTRNHSTDLHDPSQPIRYIQNQLRPQDCPEED-------DDEELTT 1025

  Fly   144 RCFPMKFQLRRTKKNCLD---CGNEL-----YYRYPITNN-------------SDLLLIKNCCEV 187
            .|  ..|..:.::.:..|   ..|.:     :.|:|.:::             ||:..:||..|:
  Fly  1026 GC--GHFVKKHSRNHSYDQIYMPNNIRFDADFLRHPHSHHNPKKNVNVLKNVVSDVGKLKNSNEI 1088

  Fly   188 EVYPA-KKVENMNNVR--VTKISGVKKFANSLLKEHSECRLFTLASQLAKQKPPLAPDVRMSRMS 249
            |...| .:..:.||.:  .||||.....:..::.:.|...|..|               |..|.:
  Fly  1089 EAGGAGSRGHSRNNSKDLNTKISSATPASGQVVTDASTTGLSVL---------------RHRRTN 1138

  Fly   250 RKSRKSRKSRKSSRKSSLFGN 270
            .|....:...:|:..||:.|:
  Fly  1139 SKDLNYQVLPESAASSSVSGH 1159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Oatp30BNP_609293.2 OATP 171..818 CDD:281175
MFS 174..>433 CDD:119392
MFS 512..>600 CDD:304372
KAZAL_SLC21 633..684 CDD:238650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.