DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco1a6

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001368859.1 Gene:Slco1a6 / 28254 MGIID:1351906 Length:670 Species:Mus musculus


Alignment Length:132 Identity:30/132 - (22%)
Similarity:45/132 - (34%) Gaps:40/132 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DNNTIVGRCFPMKFQLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNV 201
            :|..|:...|.|       .|| |.| |.:|....:|:   :|.:.....:.:|..|.:|:...:
Mouse   297 ENQGIIKEFFLM-------MKN-LFC-NPIYMLCVLTS---VLQVNGVANIVIYKPKYLEHHFGI 349

  Fly   202 RVTK------------------ISG--VKKFANSLLKE--------HSECRLFTLASQLAKQKPP 238
            ...|                  |||  :||...:|.|.        .|||.|......|.....|
Mouse   350 STAKAVFLIGLYTTPSVSAGYLISGFIMKKLKITLKKAAIIALCLFMSECLLSLCNFMLTCDTTP 414

  Fly   239 LA 240
            :|
Mouse   415 IA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco1a6NP_001368859.1 oat 1..625 CDD:273279 30/132 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.