| Sequence 1: | NP_726180.1 | Gene: | CG30278 / 246523 | FlyBaseID: | FBgn0050278 | Length: | 275 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_076207.1 | Gene: | Slco1a6 / 28254 | MGIID: | 1351906 | Length: | 670 | Species: | Mus musculus |
| Alignment Length: | 132 | Identity: | 30/132 - (22%) |
|---|---|---|---|
| Similarity: | 45/132 - (34%) | Gaps: | 40/132 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 137 DNNTIVGRCFPMKFQLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNV 201
Fly 202 RVTK------------------ISG--VKKFANSLLKE--------HSECRLFTLASQLAKQKPP 238
Fly 239 LA 240 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG30278 | NP_726180.1 | None | |||
| Slco1a6 | NP_076207.1 | oat | 1..625 | CDD:273279 | 30/132 (23%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 633..670 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||