DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco1a6

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_076207.1 Gene:Slco1a6 / 28254 MGIID:1351906 Length:670 Species:Mus musculus


Alignment Length:132 Identity:30/132 - (22%)
Similarity:45/132 - (34%) Gaps:40/132 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DNNTIVGRCFPMKFQLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNV 201
            :|..|:...|.|       .|| |.| |.:|....:|:   :|.:.....:.:|..|.:|:...:
Mouse   297 ENQGIIKEFFLM-------MKN-LFC-NPIYMLCVLTS---VLQVNGVANIVIYKPKYLEHHFGI 349

  Fly   202 RVTK------------------ISG--VKKFANSLLKE--------HSECRLFTLASQLAKQKPP 238
            ...|                  |||  :||...:|.|.        .|||.|......|.....|
Mouse   350 STAKAVFLIGLYTTPSVSAGYLISGFIMKKLKITLKKAAIIALCLFMSECLLSLCNFMLTCDTTP 414

  Fly   239 LA 240
            :|
Mouse   415 IA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
Slco1a6NP_076207.1 oat 1..625 CDD:273279 30/132 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 633..670
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.