powered by:
Protein Alignment CG30278 and Slco1a1
DIOPT Version :9
Sequence 1: | NP_001286710.1 |
Gene: | CG30278 / 246523 |
FlyBaseID: | FBgn0050278 |
Length: | 275 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_038825.1 |
Gene: | Slco1a1 / 28248 |
MGIID: | 1351891 |
Length: | 670 |
Species: | Mus musculus |
Alignment Length: | 56 |
Identity: | 18/56 - (32%) |
Similarity: | 22/56 - (39%) |
Gaps: | 17/56 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 KVENMNNVRVTKISGVKKFANSLLKEH------------SEC-----RLFTLASQL 232
|.|..:||.|||...|:|......||: |.| .||:|.|.|
Mouse 272 KKELQDNVDVTKYEKVEKHRERAKKENLGITKDFLPFMKSLCCNPIYMLFSLTSVL 327
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG30278 | NP_001286710.1 |
None |
Slco1a1 | NP_038825.1 |
oat |
1..625 |
CDD:273279 |
18/56 (32%) |
MFS |
23..>396 |
CDD:119392 |
18/56 (32%) |
KAZAL_SLC21 |
436..488 |
CDD:238650 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3626 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.