DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG30278 and SLCO3A1

DIOPT Version :9

Sequence 1:	NP_001286710.1	Gene:	CG30278 / 246523	FlyBaseID:	FBgn0050278	Length:	275	Species:	Drosophila melanogaster
Sequence 2:	NP_037404.2	Gene:	SLCO3A1 / 28232	HGNCID:	10952	Length:	710	Species:	Homo sapiens

Alignment Length:	113	Identity:	20/113 - (17%)
Similarity:	39/113 - (34%)	Gaps:	38/113 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly   126 PKPT---YKHSVILDNNTIVGRCFPMKFQLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEV 187
            |||:   .:|.:..|::   ..||.....:.:..|:.|  .|.::         ..:::..|.|:
Human   312 PKPSNGVLRHPLEPDSS---ASCFQQLRVIPKVTKHLL--SNPVF---------TCIILAACMEI 362

  Fly   188 EVYPAKKVENMNNVRVTKISGVKKFANSLLKEHSECRLFTLASQLAKQ 235
            .|                ::|...|....|::.     |.|.:..|.|
Human   363 AV----------------VAGFAAFLGKYLEQQ-----FNLTTSSANQ 389

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG30278	NP_001286710.1	None
SLCO3A1	NP_037404.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		OATP	41..619	CDD:281175	20/113 (18%)
		MFS	47..>286	CDD:119392
		KAZAL_SLC21	467..511	CDD:238650
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3626
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900