powered by:
Protein Alignment CG30278 and Slco2a1
DIOPT Version :9
Sequence 1: | NP_001286710.1 |
Gene: | CG30278 / 246523 |
FlyBaseID: | FBgn0050278 |
Length: | 275 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_201571.2 |
Gene: | Slco2a1 / 24059 |
MGIID: | 1346021 |
Length: | 643 |
Species: | Mus musculus |
Alignment Length: | 108 |
Identity: | 21/108 - (19%) |
Similarity: | 29/108 - (26%) |
Gaps: | 46/108 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 CGPCIDYRVSPPA-ADLPEPQAEVVKAVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMC 92
|.|......|.|| |::..|. ..:.|.|..|. |...|
Mouse 411 CAPLFFMGCSTPAVAEVYPPS---TPSSIHPQPPA-------------------------CRRDC 447
Fly 93 VAQEQNLHP----------NLCSAQCRPL-------KTYLHLN 118
:..:...|| :.|.|.|..| |..::||
Mouse 448 LCPDSVFHPVCGDNGVEYLSPCHAGCSSLNVSSAASKQPIYLN 490
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3626 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.