DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco2a1

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_201571.2 Gene:Slco2a1 / 24059 MGIID:1346021 Length:643 Species:Mus musculus


Alignment Length:108 Identity:21/108 - (19%)
Similarity:29/108 - (26%) Gaps:46/108 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 CGPCIDYRVSPPA-ADLPEPQAEVVKAVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMC 92
            |.|......|.|| |::..|.   ..:.|.|..|.                         |...|
Mouse   411 CAPLFFMGCSTPAVAEVYPPS---TPSSIHPQPPA-------------------------CRRDC 447

  Fly    93 VAQEQNLHP----------NLCSAQCRPL-------KTYLHLN 118
            :..:...||          :.|.|.|..|       |..::||
Mouse   448 LCPDSVFHPVCGDNGVEYLSPCHAGCSSLNVSSAASKQPIYLN 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco2a1NP_201571.2 oat 1..629 CDD:273279 21/108 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
MFS <166..>425 CDD:119392 5/13 (38%)
KAZAL_SLC21 441..494 CDD:238650 12/75 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.