DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco4c1

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_766246.1 Gene:Slco4c1 / 227394 MGIID:2442784 Length:722 Species:Mus musculus


Alignment Length:89 Identity:20/89 - (22%)
Similarity:27/89 - (30%) Gaps:42/89 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CSAQCRPLKTYLH------------------LNEWTKRPLPKPTYKHSVI----------LDNNT 140
            |:|.|..|::|.:                  ||..:.|. ||..|..|.|          .|...
Mouse   500 CNANCNCLRSYYYPLCGSDGIQYFSPCFAGCLNSVSNRK-PKVYYNCSCIERKITSTAESTDFEA 563

  Fly   141 IVGRCFPMKFQLRRTKKNCLDCGN 164
            ..|:|        ||:     |.|
Mouse   564 KAGKC--------RTR-----CSN 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
Slco4c1NP_766246.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..81
MFS_SLCO4C_OATP4C 100..602 CDD:341021 20/89 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.