DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and F47E1.2

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_509531.1 Gene:F47E1.2 / 181145 WormBaseID:WBGene00018566 Length:744 Species:Caenorhabditis elegans


Alignment Length:37 Identity:9/37 - (24%)
Similarity:13/37 - (35%) Gaps:10/37 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 CCTMCVAQEQNLHP----------NLCSAQCRPLKTY 114
            |.:.|..:...|:|          :.|.|.||....|
 Worm   532 CNSQCSCENARLYPVCDQTGFAYFSPCHAGCREAMQY 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
F47E1.2NP_509531.1 AraJ 8..>93 CDD:442063
oat 95..715 CDD:273279 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.