DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and F47E1.2

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_509531.1 Gene:F47E1.2 / 181145 WormBaseID:WBGene00018566 Length:744 Species:Caenorhabditis elegans


Alignment Length:169 Identity:32/169 - (18%)
Similarity:57/169 - (33%) Gaps:37/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SAQCRPLKTYLHLNEWTKRPL---------PKPTYKHSVILDNNTI-------VGRCFPMKFQLR 153
            ||:.:|....|..|...|:.|         |..||...:.|:::|.       :||  |.|....
 Worm   108 SAKLKPTAGQLASNSTLKQLLSYQLIRDRMPHDTYMSLINLEDDTTPIEEYQPIGR--PPKIGQG 170

  Fly   154 RTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNVRVTKISGVKKFANSLLK 218
            ::       ||..|.......|..|:..:|......       :.|.:|.:....:.:..|:..|
 Worm   171 QS-------GNSTYTIDGWLFNEALVAAENLIANNT-------SQNTLRSSLSLFIHRRTNTSTK 221

  Fly   219 EHSECRL-----FTLASQLAKQKPPLAPDVRMSRMSRKS 252
            :..:.|:     ||...:|......:..|.:....:..|
 Worm   222 DIQKIRISAAAPFTFCGKLTNSLRAVIKDSKCKEQTSNS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
F47E1.2NP_509531.1 MFS 8..>92 CDD:119392
oat 95..715 CDD:273279 32/169 (19%)
MFS <274..>503 CDD:304372
KAZAL_SLC21 528..583 CDD:238650
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.