DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Y32F6B.1

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_505689.2 Gene:Y32F6B.1 / 179463 WormBaseID:WBGene00012531 Length:760 Species:Caenorhabditis elegans


Alignment Length:101 Identity:25/101 - (24%)
Similarity:41/101 - (40%) Gaps:29/101 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 LDCGNELYYRYPITNNSDLL--LIKNC--------CE-VEVYPAKKV----ENMNNVRVTKISGV 209
            :|..|::...|.....||||  .::.|        |: :|.|.|:|.    ..|:||| ..::..
 Worm   140 IDPKNQVVMNYEGDEKSDLLQKYVEYCHYHKGSEICKNLEKYIAEKFPITDAKMSNVR-AMVALP 203

  Fly   210 KKFANSLLK----EHSECRLFTLASQLAKQKPPLAP 241
            ..|.:|:|.    :|..|:         |.:..|.|
 Worm   204 YGFCHSMLNFVRAQHYACK---------KDQSTLGP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_726180.1 None
Y32F6B.1NP_505689.2 oat 4..706 CDD:273279 25/101 (25%)

Return to query results.
Submit another query.