DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Oatp33Eb

DIOPT Version :10

Sequence 1:NP_726180.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_061513265.1 Gene:Oatp33Eb / 1279468 VectorBaseID:AGAMI1_006708 Length:823 Species:Anopheles gambiae


Alignment Length:50 Identity:15/50 - (30%)
Similarity:25/50 - (50%) Gaps:3/50 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VSPPAADLPEPQAEVVKAV--IEPDGPVRQEINIRAECSKGRPLLESDKD 84
            |||.||.... .|:||:.:  .|....:.::::.|:..|..|...:||.|
Mosquito   710 VSPLAASSAN-YAQVVRQLPKRETSSEIDEQLDFRSATSLPRGQTDSDDD 758

Return to query results.
Submit another query.