DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco1a5

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001254636.1 Gene:Slco1a5 / 108096 MGIID:1351865 Length:670 Species:Mus musculus


Alignment Length:263 Identity:56/263 - (21%)
Similarity:82/263 - (31%) Gaps:98/263 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 RAECSKGRPLLESDKDKLRCCTMCVAQEQNLHPNLCSAQCRP------LKTYLHLNEWTKRPLPK 127
            |.|..|.....|..|::.|..|      ::..|.:.|..|.|      |.:.|.:|.:.......
Mouse   281 RTENDKEEKHREKAKEENRGIT------KDFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFL 339

  Fly   128 PTY--------KHSVILDNNTIVGRC-------------FPMKFQLRRTKKN------CLDCGNE 165
            |.|        ...|:|    ::|.|             |.|| :.|.|.|.      ||.....
Mouse   340 PKYLEQQYGKSTSEVVL----LIGVCNLPPICIGYLLIGFIMK-KFRITVKKAAYMAFCLSLFEY 399

  Fly   166 L--YYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNNVRV----TKISGVKK---FANSLLKEHS 221
            |  |:.:.|:           |:             |.:|    |...||:.   ..|.:|   :
Mouse   400 LLSYFHFMIS-----------CD-------------NFQVAGLTTSYEGVQHPLYVENKVL---A 437

  Fly   222 ECRLFTLASQLAKQKPPLAPDVRMSRMSRKSRKSRKS---------------RKSSRKSSLFG-N 270
            :|.  |..|.|.....|:..|..:|.||.......||               :.|...|::.| .
Mouse   438 DCN--TRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSSGNSSAVLGLC 500

  Fly   271 KKG 273
            |||
Mouse   501 KKG 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco1a5NP_001254636.1 oat 1..625 CDD:273279 56/263 (21%)
MFS 23..>397 CDD:119392 28/126 (22%)
KAZAL_SLC21 436..488 CDD:238650 12/56 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.