DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and SLCO1B1

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_006437.3 Gene:SLCO1B1 / 10599 HGNCID:10959 Length:691 Species:Homo sapiens


Alignment Length:266 Identity:50/266 - (18%)
Similarity:91/266 - (34%) Gaps:93/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PENSCRRWIKKNWVDGPCKKCFESTCGPCIDYRVSPPAADLPEPQAEVVKAVIEPDGPVRQEINI 68
            |.:|  ||:...|::......|....        |.|...||:          .|:.|.::.   
Human   249 PTDS--RWVGAWWLNFLVSGLFSIIS--------SIPFFFLPQ----------TPNKPQKER--- 290

  Fly    69 RAECSKGRPLLESDKDKLRCCTMCVAQEQNLHPNLC-------SAQCRPL------------KTY 114
              :.|....:||::.:|.:...: ..|.:|:..|:.       |....||            .:|
Human   291 --KASLSLHVLETNDEKDQTANL-TNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSY 352

  Fly   115 L----HLNEWTKRPLPKPTYKHSVILDNNTI--------VGRCFPMKFQLRR---TKKNCLD--- 161
            :    ::.::.::...:|:.|.:::|...||        :|.....||:|..   .|.:|..   
Human   353 IGAFTYVFKYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVM 417

  Fly   162 ------------CGNE----LYYRY----PITNNSDLLLIK-----NCCEVEVYPAKKVENMNNV 201
                        |.|:    |...|    |:|::.|:.|..     ||.|.:..|.     ..|.
Human   418 SLSFYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPV-----CGNN 477

  Fly   202 RVTKIS 207
            .:|.||
Human   478 GITYIS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
SLCO1B1NP_006437.3 OATP 29..621 CDD:281175 50/266 (19%)
MFS 31..>427 CDD:119392 34/203 (17%)
KAZAL_SLC21 455..508 CDD:238650 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.