DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30278 and Slco2b1

DIOPT Version :9

Sequence 1:NP_001286710.1 Gene:CG30278 / 246523 FlyBaseID:FBgn0050278 Length:275 Species:Drosophila melanogaster
Sequence 2:XP_011239939.1 Gene:Slco2b1 / 101488 MGIID:1351872 Length:697 Species:Mus musculus


Alignment Length:197 Identity:42/197 - (21%)
Similarity:60/197 - (30%) Gaps:63/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CIDYRVSPPAADL---PEP------------QAEVVKAVIEPDGPVRQEINIRAECSKGRPLLES 81
            |..::::....||   |.|            |::....|.:....|.......|.|: ||.:.|:
Mouse   468 CSTHQIAGITQDLGAQPGPSLFPGCSEPCSCQSDDFNPVCDTSAYVEYTTPCHAGCT-GRVVQEA 531

  Fly    82 -DKDKL---RCCTMCVAQEQNLHPNLCSAQCR----PLKTYLHLNEWTKRPLPKPTYKHSVIL-- 136
             .|.::   .|  .|||....:....|.:.|.    |......|.    ..|...|:..|.:|  
Mouse   532 LGKSQVFYTNC--SCVAGNGTVPAGSCESACSRLVLPFIVLFSLG----AGLASITHTPSFMLIL 590

  Fly   137 ------DNNTIVGRCFPMKFQLRRT--------------KKNC----LDCGNELYYRYPITNNSD 177
                  |....||    |:|.|.|.              ...|    |.||.....||   .:.|
Mouse   591 RGVKKEDKTLAVG----MQFMLLRVLAWMPSPVIHGSAIDTTCVHWALTCGRRAVCRY---YDHD 648

  Fly   178 LL 179
            ||
Mouse   649 LL 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30278NP_001286710.1 None
Slco2b1XP_011239939.1 MFS 54..591 CDD:391944 26/129 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3626
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.