DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30274 and zgc:172076

DIOPT Version :9

Sequence 1:NP_726252.1 Gene:CG30274 / 246521 FlyBaseID:FBgn0050274 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001107070.1 Gene:zgc:172076 / 563955 ZFINID:ZDB-GENE-080204-38 Length:317 Species:Danio rerio


Alignment Length:324 Identity:79/324 - (24%)
Similarity:141/324 - (43%) Gaps:54/324 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GIIAPDFDVFVVFQEFLVPLLKDMHCLSIDADFKPQPRLAYFPMDNGERLNTAAFVFDDESQLVT 193
            |.:|.|...:::|.:|...:::..|...:.:|...:....|..:..|:         |.:...|:
Zfish    19 GCLAGDAQSYILFCDFFDRIIESYHGYKVTSDAVHESDFNYDNLKGGD---------DFDPAYVS 74

  Fly   194 RCLVEVSRNLDQLELPLNLTIGQLEQAERLMMSKIFTTHFADAIGETDSGNYYTMTELL--EPDS 256
            .|.|.|||:::....|.:.:.|     ||..:..:..|.. :.:||...|..|::.||.  ..|.
Zfish    75 GCEVTVSRSVEDFSFPTHCSRG-----ERRRLLTLANTAL-EQLGEDLPGKLYSIDELSHESEDR 133

  Fly   257 EVTMMLSSLGLMIPLLDTKDLVQAAESTAFNGALWPYGRGAFVNSANNMAVWLNCQEHLRIISTT 321
            :|.|......| |.:...:|              ||..|..:::...::|||:|.::||:::|..
Zfish   134 KVVMEFPPASL-IKIGVARD--------------WPDARALWLSKDGSLAVWVNMEDHLKLVSYR 183

  Fly   322 SSKEPADMGAAYTRVGRAITYLET-QLHFKESYL----LGYLQSRPSYLGTGLKMTTIVKLTNLM 381
            |.   |.:..|:..:...:..||| ....:.:::    ||::.|.|:.:|||||.:..|.|.||.
Zfish   184 SD---ASLQEAFKTICINVQKLETLYKKLRHTFIWKTHLGWVVSSPAEVGTGLKASVSVNLLNLA 245

  Fly   382 KE------MDNLRHLCSVRGLSMVTNRLSKLTVRLVNMQSMGVVEYVLFQDYCTAVTNILSLEK 439
            |.      :|.||       |.|.|.. .....::.|:|::||.|..|.|.....|..::.:||
Zfish   246 KNKRLDDILDRLR-------LQMETTS-DPGVYKISNLQTIGVTEVGLTQLVVDGVKLLIRMEK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30274NP_726252.1 phosphagen_kinases 75..440 CDD:295496 79/324 (24%)
zgc:172076NP_001107070.1 phosphagen_kinases 3..309 CDD:295496 79/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.