DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30274 and CKMT1A

DIOPT Version :9

Sequence 1:NP_726252.1 Gene:CG30274 / 246521 FlyBaseID:FBgn0050274 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001308856.1 Gene:CKMT1A / 548596 HGNCID:31736 Length:448 Species:Homo sapiens


Alignment Length:353 Identity:79/353 - (22%)
Similarity:148/353 - (41%) Gaps:72/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GIIAPDFDVFVVFQEFLVPLLKDMHCLSIDADFKPQPRLAYFPMDNGERLNTAAFVFDDESQLVT 193
            |::|.|.:.:.||.:...|::::.|     ..:.|:.......:| ..::.:.  .||:...|.:
Human   137 GMVAGDEETYEVFADLFDPVIQERH-----NGYDPRTMKHTTDLD-ASKIRSG--YFDERYVLSS 193

  Fly   194 RCLVEVSRNLDQLELPLNLTIGQLEQAERLMMSKIFTTHFADAI----GETDSGNYYTMTELLEP 254
            |  |...|::..|.||...|..:..:.||:::         ||:    |:. :|.||.::|:.|.
Human   194 R--VRTGRSIRGLSLPPACTRAERREVERVVV---------DALSGLKGDL-AGRYYRLSEMTEA 246

  Fly   255 ------------DSEVTMMLSSLGLMIPLLDTKDLVQAAESTAFNGALWPYGRGAFVNSANNMAV 307
                        |..|:.:|::.|:      .:|              ||..||.:.|:..:..:
Human   247 EQQQLIDDHFLFDKPVSPLLTAAGM------ARD--------------WPDARGIWHNNEKSFLI 291

  Fly   308 WLNCQEHLRIISTTSSKEPADMGAAYTRVGRAITYLETQL-----HFKESYLLGYLQSRPSYLGT 367
            |:|.::|.|:|   |.::..:|...:.|..|.:..:|..:     .|..:..|||:.:.||.|||
Human   292 WVNEEDHTRVI---SMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGT 353

  Fly   368 GLKMTTIVKLTNLMKE------MDNLRHLCSVRGLSMVTNRLSKLTVRLVNMQSMGVVEYVLFQD 426
            ||:....:||..|.|:      ::|||  ...||...|....:.....:.|:..:|..|..|.|.
Human   354 GLRAGVHIKLPLLSKDSRFPKILENLR--LQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQL 416

  Fly   427 YCTAVTNILSLEKDMSLTNSKHIATMLV 454
            ....|..::..|:.:.......|.|.::
Human   417 VIDGVNYLIDCERRLERGQDIRIPTPVI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30274NP_726252.1 phosphagen_kinases 75..440 CDD:295496 77/337 (23%)
CKMT1ANP_001308856.1 creatine_kinase_like 80..437 CDD:153076 77/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.