DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30274 and Ckmt1

DIOPT Version :9

Sequence 1:NP_726252.1 Gene:CG30274 / 246521 FlyBaseID:FBgn0050274 Length:468 Species:Drosophila melanogaster
Sequence 2:NP_001012756.1 Gene:Ckmt1 / 29593 RGDID:61976 Length:418 Species:Rattus norvegicus


Alignment Length:357 Identity:82/357 - (22%)
Similarity:148/357 - (41%) Gaps:82/357 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GIIAPDFDVFVVFQEFLVPLLKDMHCLSIDADFKPQPRLAYFPMDNGERLNTAAFVFDDESQLVT 193
            |::|.|.:.:.||.|...|::::.|     ..:.|:.......:| ..::.:.  .||:...|.:
  Rat   107 GMVAGDEETYEVFAELFDPVIQERH-----NGYDPRTMKHTTDLD-ASKIRSG--YFDERYVLSS 163

  Fly   194 RCLVEVSRNLDQLELPLNLTIGQLEQAERLMMSKIFTTHFADAI----GETDSGNYYTMTELLEP 254
            |  |...|::..|.||...|..:..:.||:::         ||:    |:. :|.||.::|:.|.
  Rat   164 R--VRTGRSIRGLSLPPACTRAERREVERVVV---------DALSGLKGDL-AGRYYRLSEMTEA 216

  Fly   255 ------------DSEVTMMLSSLGLMIPLLDTKDLVQAAESTAFNGALWPYGRGAFVNSANNMAV 307
                        |..|:.:|::.|:      .:|              ||..||.:.|:..:..:
  Rat   217 EQQQLIDDHFLFDKPVSPLLTAAGM------ARD--------------WPDARGIWHNNEKSFLI 261

  Fly   308 WLNCQEHLRIISTTSSKEPADMGAAYTRVGRAITYLETQL-----HFKESYLLGYLQSRPSYLGT 367
            |:|.::|.|:|   |.::..:|...:.|..|.:..:|..:     .|..:..|||:.:.||.|||
  Rat   262 WVNEEDHTRVI---SMEKGGNMKRVFERFCRGLKEVEKLIQERGWEFMWNERLGYILTCPSNLGT 323

  Fly   368 GLKMTTIVKLTNLMKE------MDNLRHLCSVRGLSMVTNRLSKLTVRLVNMQSMGVVEYVLFQD 426
            ||:....|||..|.|:      ::|||  ...||...|....:.....:.|:..:|..|..|.|.
  Rat   324 GLRAGVHVKLPLLSKDSRFPKILENLR--LQKRGTGGVDTAATGSVFDISNLDRLGKSEVELVQL 386

  Fly   427 YCTAVTNILSLEKDMS----------LTNSKH 448
            ....|..::..|:.:.          |.:.||
  Rat   387 VIDGVNYLIDCERRLEKGQDIRIPPPLVHGKH 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30274NP_726252.1 phosphagen_kinases 75..440 CDD:295496 79/337 (23%)
Ckmt1NP_001012756.1 Cardiolipin-binding. /evidence=ECO:0000250 40..64
creatine_kinase_like 50..407 CDD:153076 79/344 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341351
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3869
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D825025at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.