DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and YOL162W

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_014480.1 Gene:YOL162W / 854002 SGDID:S000005522 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:235 Identity:47/235 - (20%)
Similarity:83/235 - (35%) Gaps:53/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWVMAFVYLIIADILLTRGI 322
            |..:|...:|.|::|.|..:.|..|.||.:     .|...|.:.|......:.|.:...|.|..:
Yeast    13 ATYLTLVLRSIGFTTFQANLLAIPNFVLHI-----LLLFGLTWSTEKCNNRLGLSLLQPLYTVPL 72

  Fly   323 MSITGIRK----------SVNSIAFFVPAAALIGVSFLD-NTQ--KTLAVVLMCANVGINAGSTI 374
            :::....|          ::.::....|....|.||... |:|  ||..|.....|:.:.||..|
Yeast    73 LAVLRFWKGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQSVKTRTVSTCLYNMFVQAGLII 137

  Fly   375 GSTINTIDLSPNHA---GILMGIVNTASNIVPILTPLLVGIIVKDDHDREQWQIVFIISAVIFCV 436
            .|.|.....:|.:.   |:|.|       :...:.|:|:|                         
Yeast   138 SSNIYAKSDAPLYRKGNGVLFG-------LALFMFPILIG------------------------- 170

  Fly   437 GNIVYVAFGKMVNQPWDAPDFMDKQRSSNLQEVGHSKALE 476
            ..::||...|..::.|:|....:|....:......|:.|:
Yeast   171 SKLIYVYINKQRDKRWNAMSEEEKDHYLSTTSDAGSRRLD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 41/201 (20%)
2A0114euk 19..456 CDD:129972 44/213 (21%)
YOL162WNP_014480.1 MFS <1..169 CDD:421695 37/167 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.