DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and TNA1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_011776.1 Gene:TNA1 / 853175 SGDID:S000003492 Length:534 Species:Saccharomyces cerevisiae


Alignment Length:477 Identity:90/477 - (18%)
Similarity:178/477 - (37%) Gaps:129/477 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PMIGQRHLQTFLLFLSIVVNYMAKFNAGVAVVAMTNAE--------NTNPNFPEYDWNEMERSYI 65
            |::|      .|.|||    .:.|.|.|.|.||..:.:        ||                .
Yeast    94 PLMG------MLYFLS----NLDKSNIGNAEVAGLSKDIHLVGTQYNT----------------C 132

  Fly    66 LSSFFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWC---VSWG-GWQAYCA----I 122
            ::.||..|:|...:|           |..:..:|..|::.:...|   :|.| .|....|    :
Yeast   133 VTVFFATYVLFDPIG-----------TNLLKIMGPPLMMSICLTCFGAISLGTAWVKNYAQLIVV 186

  Fly   123 RMSMGLFQGFLFPCIHAHLANWCPVKERNRLG-----ALANTGIDCGTLVAMFASGLLAASSIGW 182
            |:.:|.|:|.::|.|:.:| :.|..:|:..|.     :.|......|.|:| :....::.|...|
Yeast   187 RLLLGAFEGMIYPAINMYL-SVCYRREQYALRFAFVFSAACLSSSFGGLIA-YGCSKISGSLKDW 249

  Fly   183 PGIFYVSCGVGVLWCIVWWIFGANQPRE-SKFIGEAELNYIE---TSINSSRKAEEAELKATGPI 243
            ..|:.|. |...|..:.::.||.::..| |.|..:.|..||.   .::|:....|:.|       
Yeast   250 QYIYIVE-GCISLGFVPFYAFGLSKNLEDSWFFNKEEKEYISERYKTMNTFDPDEKFE------- 306

  Fly   244 PVPWKAIWTS---VPFWALMVTRCCQSWGYSTLQTEMPAYMNGVLLMDMKSNALYSALPYLTSWV 305
               |..:|.:   |..||..|...........|...:|..:..:...::::..:...:.:||: :
Yeast   307 ---WFQVWQAVKDVKTWASAVALFGIDLTTFGLTVFLPIIITSMGFTNVRAQLMTVPIYFLTA-I 367

  Fly   306 MAFVYLIIADILLTRGIMSITGIRKSVNSIAFFVPAAAL---IGVSFLDNTQ----KTLAVVLMC 363
            :.|:..:.:|.:..|               :.|:..|.|   ||::.:..:|    :...|.::|
Yeast   368 VFFICAVWSDRIKLR---------------SPFILGACLTTSIGIAIVLGSQVHGVRYFGVYILC 417

  Fly   364 ANVGINA---------------------------GSTIGSTINTIDLSPNHAGILMGI-VNTASN 400
            ..:.:||                           ||..|.....|.::.:....:.|: ::.|..
Yeast   418 MGIYVNAACNCLWLSGNTGNYFKRATALGINLFFGSGSGLVSGQIFVAKDKPRYIKGLSISLAFQ 482

  Fly   401 IVPILTPLLVGIIVKDDHDREQ 422
            :..|...::...:.|.::|:::
Yeast   483 VFSIFMTVVQIFLYKRENDKKK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 88/468 (19%)
2A0114euk 19..456 CDD:129972 88/467 (19%)
TNA1NP_011776.1 MFS_FEN2_like 87..490 CDD:340885 88/461 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.