DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and SEO1

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_009333.1 Gene:SEO1 / 851230 SGDID:S000000062 Length:593 Species:Saccharomyces cerevisiae


Alignment Length:350 Identity:75/350 - (21%)
Similarity:118/350 - (33%) Gaps:118/350 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NEMERSYILSS--FFWGYILTQFMGGWLCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYC 120
            |::..:|:|.|  ..|..:                      |:|:| .|..:|...         
Yeast   199 NKLPLNYVLPSLDLCWSLL----------------------TVGAA-YVNSVPHLK--------- 231

  Fly   121 AIRMSMGLFQG-------FLFPCIHAHLANWCPVKERNRLGALANTGIDCGTLVAMFASGLLAA- 177
            |||..:|.|:.       :||...:.|       .|..|..|....|...|.|   .|.|:.:| 
Yeast   232 AIRFFIGAFEAPSYLAYQYLFGSFYKH-------DEMVRRSAFYYLGQYIGIL---SAGGIQSAV 286

  Fly   178 -SSI-------GWPGIFYVSCGVGVLWCIVWWIFGANQPRE--SKFIGEAELNYIETSINSSR-- 230
             ||:       ||...|.:...|.|:..::.:......|..  |.|:.:.|:......:..::  
Yeast   287 YSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTG 351

  Fly   231 ----KAEEAELKATGPIPVPWKAIWTSVPFWALMVTRC----CQSWGYSTLQTEMPAYMNGVLLM 287
                :.:..::|.       ||.|::.   |.:.:...    |  |..|.:.       :|..|:
Yeast   352 KSDFETKVFDIKL-------WKTIFSD---WKIYILTLWNIFC--WNDSNVS-------SGAYLL 397

  Fly   288 DMKSNALYSALPYLTSWVM-----AFVYL----IIADILLTRGIMSITGIRKSVNSIAFFVPAAA 343
            .:||...|| :|.|....|     ..|||    ||||.|.:|....|            |.....
Yeast   398 WLKSLKRYS-IPKLNQLSMITPGLGMVYLMLTGIIADKLHSRWFAII------------FTQVFN 449

  Fly   344 LIGVSFL---DNTQ--KTLAVVLMC 363
            :||.|.|   |..:  |..|.:|.|
Yeast   450 IIGNSILAAWDVAEGAKWFAFMLQC 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 74/349 (21%)
2A0114euk 19..456 CDD:129972 74/349 (21%)
SEO1NP_009333.1 MFS_FEN2_like 134..548 CDD:340885 74/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I2980
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.