DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MFS1 and THI73

DIOPT Version :9

Sequence 1:NP_726254.1 Gene:MFS1 / 246519 FlyBaseID:FBgn0050272 Length:497 Species:Drosophila melanogaster
Sequence 2:NP_013104.1 Gene:THI73 / 850690 SGDID:S000003994 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:492 Identity:94/492 - (19%)
Similarity:156/492 - (31%) Gaps:174/492 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLFL-SIVVNYMAKF------------NAGVAVVAMTNAENTNPNFPEYDWNEMERSYILSSFFW 71
            |:|| ..::||.|..            |.|....|            .|.:.|...:|::..|..
Yeast    92 LMFLDKALLNYAASMGIKDHLKGNEFSNLGTIFSA------------AYIFMEPVVTYLIQKFPI 144

  Fly    72 GYILTQFMGGW--------LCRRYGARITMFVSTIGSALLVVLIPWCVSWGGWQAYCAIRMSMGL 128
            ..||..|:..|        .|:.|            ::|:||                 |..:||
Yeast   145 SKILGTFITVWGIVLACHAACKTY------------ASLMVV-----------------RTLLGL 180

  Fly   129 FQ-GFLFPCIHAHLANWCPVKERNRLG---ALANTGIDCGTLVAMFASGLL---AASSIGWPGIF 186
            |: .....||......:...::..|:|   ..|.||...|.|::.   |.|   ..:...|..:|
Yeast   181 FESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVGGLISF---GFLHYHGTAFTSWQIMF 242

  Fly   187 ----YVSCGVGVLWCI--------VWWIFGANQPRESKFIGEAELNYIETSINSSRKAEEAEL-- 237
                .|:...|||..:        .|::   |:..:.:.:.....|.........:|.:..||  
Yeast   243 LVVGLVTVAFGVLTFLYLPDNVTNAWFL---NKEEKIQVVEHIRANQTGLETKKFKKQQVKELFL 304

  Fly   238 --KATGPI-------PVPWKAIWT-------------------SVPFWA------LMVTRCCQSW 268
              |.|.|:       .:...||.|                   .:|..|      |:.|:....|
Yeast   305 HDKFTWPMLLLTACSQISTGAIGTFSVTITGTFGFDKYETALLQLPIGAITAMIILITTQMLSRW 369

  Fly   269 GYSTLQTE---MPAYMNGVLLMDM----KSNALYSA-LPYLTSWVMAFVYLIIADILLTRGIMSI 325
            |:.||.|.   :||.:..::|:.:    |...|:|. |.|..|.|:..:|:        ....:.
Yeast   370 GHITLITTSMYIPAIIGCIVLISLPLSHKIGNLFSLYLLYSGSCVITNIYI--------WNSCNT 426

  Fly   326 TGIRKSV--NSIAFFVPAAALIGVSFLDNTQKTLAVVLMCANVGINAGSTIGSTINTIDLSPNHA 388
            :|..|.|  |:|...|                            .|....|...:.....:|.:.
Yeast   427 SGYTKRVFRNAITMIV----------------------------YNVSCIIAPQMFRAYSAPRYI 463

  Fly   389 GILMGIVNTASNIVPILTPLLVGIIVKDDH---DREQ 422
            ...:.::.|....||:  .|.:|.|.|.::   |:||
Yeast   464 PAKIALLVTQCVCVPL--QLYIGYICKKENEKRDKEQ 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MFS1NP_726254.1 MFS 18..444 CDD:119392 94/492 (19%)
2A0114euk 19..456 CDD:129972 94/492 (19%)
THI73NP_013104.1 MFS_FEN2_like 77..481 CDD:340885 87/473 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I1824
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X142
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.